CDH23 antibody (Middle Region)

Catalog No. ABIN634752

This anti-CDH23 antibody is a Rabbit Polyclonal antibody detecting CDH23 in WB. Suitable for Human and Mouse.

Quick Overview for CDH23 antibody (Middle Region) (ABIN634752)

Target: CDH23 (Cadherin 23 (CDH23))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDH23 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CDH23 Antibody

Binding Specificity: Middle Region

Specificity: CDH23 antibody was raised against the middle region of CDH23

Purification: Affinity purified

Immunogen: CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH23 Blocking Peptide, (ABIN937626), is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDH23

Target: CDH23 (Cadherin 23 (CDH23))

Alternative Name: CDH23

Background: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound